SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2AJL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2AJL4
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily CATH 1.11e-61
Family CATH 0.00000245
Further Details:      
 
Domain Number 2 Region: 66-147
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.79e-26
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B2AJL4
Sequence length 155
Comment (tr|A0A1B2AJL4|A0A1B2AJL4_DROME) GEO13284p1 {ECO:0000313|EMBL:ANY27347.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN= OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWT
GDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHG
DIVTIGECRPLSKTVRFNVLKVSKGQGAKKSFKKY
Download sequence
Identical sequences A0A0J9TZF2 A0A1B2AJL4 B3NS62 Q0E9B6 Q6XHX5
NP_725114.1.81976 XP_001975964.2.56816 XP_002091106.2.41174 XP_016027109.1.80810 FBpp0087115 7303497___KOG1728 001553281|e4v6wAL1|2.1.1.371|AL:1-155 FBpp0087114 7227.FBpp0087113 FBpp0087115 4v6w_AL

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]