SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2AK02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2AK02
Domain Number 1 Region: 14-92
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.61e-29
Family eIF5a N-terminal domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 85-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-22
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B2AK02
Sequence length 159
Comment (tr|A0A1B2AK02|A0A1B2AK02_DROME) Eukaryotic translation initiation factor 5A {ECO:0000256|RuleBase:RU362005} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN= OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMV
GIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGE
LGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNTALDK
Download sequence
Identical sequences A0A1B2AK02 Q9GU68
FBpp0072081 FBpp0072082 FBpp0072081 FBpp0072082 7291729___KOG3271 NP_611878.1.81976 NP_726411.1.81976 FBpp0072081 7227.FBpp0072081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]