SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6CW90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6CW90
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-28
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 219-323
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.12e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 377-468
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000115
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6CW90
Sequence length 479
Comment (tr|A0A1B6CW90|A0A1B6CW90_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS17772.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.32297 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
MGDNINFSKRVKKFGTTMSESKCSNLLSLEENETVFHLLGPRCQSLATTVIQLYITIGAE
HNEWYKKDTGVLCLVKDNLRRSYFFRLYCPSRQQLVWEHEVYNSMEYNAPQNYLHTFEAE
DYIAAFSFVSEEEAAWLRSILLAKLETKKQRRERKSQRLNQRDLPGIPSYSTSNGIITSQ
QQILTNSQLSNRVNNNKGIKKKKDKSKKLSKADIGTPKNFRHISHVGWDADKGFEYDLAN
NDDPSLQSFLHKAGVSEKHMQDRETRDFIYDFIEKNGGLEAVKQEEPPVSRSVSTANRAA
PPPPPPRIGAFPASLQSPPPLPPLRTIPQRNHEGLNAVVPPPPEASFPPPPPPPPLPGPK
FDLNPAPLPTPTPSVLPGITDVRSQLMESIRSGASLKHVEVDSKNKQDSRGELLDQIRQG
VELKSVQPIVRSNEVKEKMGSGLAGALARALAERSKVIHSESSTSSDDDDDDGDDEWED
Download sequence
Identical sequences A0A1B6CW90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]