SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6LK99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6LK99
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.98e-24
Family BAR domain 0.011
Further Details:      
 
Domain Number 2 Region: 114-181
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000134
Family SH3-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6LK99
Sequence length 182
Comment (tr|A0A1B6LK99|A0A1B6LK99_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAT24067.1} OX=36148 OS=Graphocephala atropunctata. GN=g.12111 OC=Membracoidea; Cicadellidae; Cicadellinae; Cicadellini; Graphocephala.
Sequence
MKSILKERGILESKRLDLDACKNRVRKARSMLGQPTAERDLRVAQSEFDRQAEITKLLLE
GVSSSHTRHLRCLHEFVEAQVTFYAQCHEAMQELQKDIASMSMGKPNNSPAMAHAHPSPS
PSSVGQRARVLCDYDAKDSTELSLMTDEVITVQKIDGETDYMLAERGNQRGRVPMAFLDL
IN
Download sequence
Identical sequences A0A1B6LK99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]