SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7V4B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7V4B6
Domain Number 1 Region: 289-626
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.02e-50
Family Patatin 0.0000304
Further Details:      
 
Domain Number 2 Region: 9-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.69e-30
Family Laminin G-like module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B7V4B6
Sequence length 636
Comment (tr|A0A1B7V4B6|A0A1B7V4B6_9NOST) Patatin {ECO:0000313|EMBL:OBQ09541.1} KW=Complete proteome OX=1710892 OS=Anabaena sp. LE011-02. GN=AN482_11100 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MTNQVNTQSVLTFDGQDDYINFGKNDIGGVFAQGSSAFTISGWVNPHQLTNKATTYGAHN
VFFARSSDRYSDNFEFGISEEGNLDVYIDENIDNVIKTFGNGELTIGQWHFFAIVFNGGQ
LTIYLDDHEYTGSLTGSSLNKATSPITMGATLHNNVYFTGQLANISVWNYPCTQDQIQTH
RSSPLVGNEPGLVAYWRLNEGEGTTVQDQSGNTHNGTLYGNPSWNLAQVLFAIAQSSSEG
HRPSSSPAEIAEIAQTTEYPIPDNIQQQEQAQTPSKEESKQTMNNTANPKYKILAIDGGG
IRGIIPAIILTEIEKRTQKQIFSLFDLIAGSSSGGILSLGLTKPRLDLAGSDSPPVAQYS
AEELLQIYLEYGAEIFYEPFWEQLLGQLEDIFVQPKYSSEGREEIIKQYFGDSPLENNLK
EVFVTSYDIEQRIPIFFTNKLEKQQTKSKKFRKLCLGFTLTDAALATSATPTYFAPYRVS
SSHNTNGFYTLVDGGLVANNPANLAILEAQISRQENQQALNIEDILVVSLGTGSLTSVYP
YDQVKNWGLLQWTKPLLNMVLDGGSEVVAGELERLFEATNKGHKTSYYRFQPFLKSELED
IDNAKPENLRQLQTLANILIQEKNQEIDELCSILSS
Download sequence
Identical sequences A0A1B7V4B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]