SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8XV10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8XV10
Domain Number 1 Region: 14-287
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-82
Family Eukaryotic proteases 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B8XV10
Sequence length 386
Comment (tr|A0A1B8XV10|A0A1B8XV10_XENTR) Uncharacterized protein {ECO:0000313|EMBL:OCA14505.1} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=XENTR_v90026645mg OC=Silurana.
Sequence
mtrqtfnllpiffiffifyliyesesaiggicgnrplfnkgsrivggqnsppgkwpwmvs
iqsptgkefshlcggsvlneiwvltaahcfkhlerkeetkswrlvfgannlkvlessvqi
rkikevvqpkaynptteanditllrldkpivftdyvqpacfptefanvekktdcyiagwg
vldeesgepseilqearvhqidskkcnskdwydgsigeynlcaghekggidscqgdsggp
lmcktqksrtyavvgitswgsgcargkkpgvytstkyfikwiaskvetdekpkirkkrsl
lkniilpngqlpdaeieeltqtqtqgtetnpvrptaqiqefqygrekgtqvqsgpiegkl
kpeiavqvptenilkrimswlltdmr
Download sequence
Identical sequences A0A1B8XV10
gi|301603863|gb|XP_002931607|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]