SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B8Y4M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1B8Y4M3
Domain Number - Region: 24-76
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00366
Family Thyroglobulin type-1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B8Y4M3
Sequence length 197
Comment (tr|A0A1B8Y4M3|A0A1B8Y4M3_XENTR) Uncharacterized protein {ECO:0000313|EMBL:OCA17843.1} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=XENTR_v90026555mg OC=Silurana.
Sequence
mfpsekfrkaagvlltislsglvcslliyallleagsiaisgckkigfynyclyngtsag
cycitdqegltavglncqkgllmslvltysslvtflmglltmalalsfnertlwmfpqvf
nglslaglsvgllmylcltwglydiselstgflalllaivglillssimrhysrltanpf
ktpttddisdqkynlvv
Download sequence
Identical sequences A0A1B8Y4M3
gi|301624359|gb|XP_002941472| gi|301624361|gb|XP_002941473| XP_002941473.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]