SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3HHN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3HHN1
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Phage tail protein-like 8.37e-46
Family STM4215-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C3HHN1
Sequence length 180
Comment (tr|A0A1C3HHN1|A0A1C3HHN1_SERMA) Gp37 protein {ECO:0000313|EMBL:SAY44549.1} OX=615 OS=Serratia marcescens. GN=PWN146_03259 OC=Yersiniaceae; Serratia.
Sequence
MNVSELLSAVVLRLRAKLPALHVDFFPESPAEFRLNHPVGAVLVSYGKSTFGKTQDVGVV
IQPQTVRFNATAVLRQLNGKGGAVDVLDLLRQSLGGWRPPDCQRDIWLVEDVFLGQREGL
WQYVLTFETVTVFVQDSESADLPLLTQVEYEDINEIHLQRPGERGDAALRGSAAGDPAVP
Download sequence
Identical sequences A0A1C3HHN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]