SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C3KF29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C3KF29
Domain Number 1 Region: 229-505
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-38
Family Duffy binding domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 516-599
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000288
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C3KF29
Sequence length 847
Comment (tr|A0A1C3KF29|A0A1C3KF29_PLAFA) Duffy binding protein 2, putative {ECO:0000313|EMBL:SBT72196.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=POWCR01_000022500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFLNIKKNEKDILYILKRKLQNGKNNESNYFYSFFEKNHKSVVNIVEEIDKYEKYYTQGM
NDMLAKQHRKNGEKKIELFVRASNKNITGKKEKIREVIKGTKKNDKEFNGKRTSRQLEET
DDVTGKFRDKIYIGDKYGRDNLIKNGSNSNAYDSENMNNKIPSNNQSQKSLYDSREFVHM
PDILSSDAEHEVVAITDIHNDKIYTTTVPNYSFIDYHFLVGCKTKRNGIWNCNKEDVNEE
RMCIPDRRIQLCIYILMYLKDNNYSNNLKIRLLVSLNSEIILLLNKWNVNGKFDNDAFCN
DLRNDYADYGDVVKGTDMDDRDYSEEVELRLKKVFGNDDNGKRKRMEWWYANKEYIWNKT
LSLVKERANDITIVECTKEPNFEEIPQFQRWIQEWFTNSYGVRDKKLKSLEGICEKENHS
VRENGCNIGVECKKACLEYDKWKYEKKKQCYILLKKFSRVKDNEMFIQKESIDTISKKLS
KVCEEVNKVETNSTDNIYNNFCKCKASMGFFSERECKNEEECKRMCNAYTSWIKQKIQER
NALSQKFEIVKDTAKNAQGGDTENAPNFLVQVCKEFNWLDFEKIFDLSYIIYKNVCNCKT
VRNTKFFQLRMEGKKPECTSTPSTVTYEALKISGGKENSFNHTDSSSTTNLSRSVLDIKN
SSDAHSSYNESDKNAYDSERDPGTDNTRMRFENESINTSAMGTISNSEKENVDNYPNSAH
TTVHFEGNNISTNMLINRDNGNDLSKFSNINNPASDGDAQKTEVNKRSHNNYNIIDKNNE
SADGMKCKHYTNQNGDNSSPFATGSLKESSIVNKALTGTVIGLTNINKEEEKNVEKHNFS
RSNTYDE
Download sequence
Identical sequences A0A1C3KF29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]