SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1C6YC37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6YC37
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.22e-30
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 181-293
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.99e-22
Family Thioltransferase 0.043
Further Details:      
 
Domain Number 3 Region: 418-532
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000013
Family Thioltransferase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1C6YC37
Sequence length 553
Comment (tr|A0A1C6YC37|A0A1C6YC37_PLACH) Heat shock protein, putative {ECO:0000313|EMBL:SCM20714.1} OX=5826 OS=Plasmodium chabaudi adami. GN=PCHDS_000189400 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MNATNEKKRKRITNFNSIIWLLLSFFLTCSEGMDYYKRLGLKRNATKDDISKAYRKLAKE
YHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGENYAEASQGFGGGSGGPGGAGAGG
FGNGFPFDQDVVNEIFRQFAGGGRGGNQGGNFHFKFSSGGNKGYNSGPRYGGHHPFEEEY
YEDIYKNEVLKLNSKNSSSIIDDISYSLLINFYSSSSSECISFKKTYLKLSKKYDGYINF
AVVNCDQEKALCKKYKVRSLPHIILMKKNKTYETLYGSKTEDNVKSFINNNIPYSLTEIN
NKKNLDKFLTKSADIPKVLFFISHKDNIIMLKVLSMEFEKRLNIGIVYDSNYTIMKIFKK
KNIKAPSLLLIEDIDTLEGDLTHLKTVDFNILSLKLSHIVAQHRLKNNLYGHVTSYQELT
KKKYDAGHCNEKDSQICFFILKLLNQNYKSLDEDIKKVATKFSNDPLKILYINVFNQPYI
LDSFGLTNECKHSNCLILVAFRPKRQRYRVFDGEVNYNNVLNFVDNVVSGGLSINQNIKQ
GLNFVNNSYYDEL
Download sequence
Identical sequences A0A1C6YC37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]