SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D1Y2R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D1Y2R6
Domain Number 1 Region: 58-130
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000778
Family Chaperone J-domain 0.0028
Further Details:      
 
Domain Number 2 Region: 310-398
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000033
Family Thioltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D1Y2R6
Sequence length 713
Comment (tr|A0A1D1Y2R6|A0A1D1Y2R6_9ARAE) DnaJ subfamily C member 10 {ECO:0000313|EMBL:JAT48911.1} OX=1678845 OS=Anthurium amnicola. GN=g.50405 OC=Potheae; Anthurium.
Sequence
SLSLSLRDPEYPTVATNMPETPAAEASTAAVTSPAALSPIRRYALPALLFALGLFYQLVI
LPSSFPPSHYGVLGVAEFASVEEVAGAYEKFSSKWSSGLDIPTTMDFIKIRYAFELLTNP
LWKRDYDMFGIDEQLYIIEKLRDQYYGQRFSEVHLPLLDASSVDTMEQAEGIITTEDFTS
SVGKNETWLIQVYSSGSRRCTNFSNSWKRISSLLDGVANTGSVELGEVQLASFLAERRSA
KQPLFRNGLPSLVAFLPNCRSSHCYVRYDGDLSVDSTIDWLATSVLGLPRILYYSSQSLV
QNFIAKSGQHKIKVIFFSKTGERAAPFLRQSAKDYWAYAAFACVLWTEEESSMWWNKLGV
ESAPAIIFLKDPGVKPIVYHGTFNSSWFVNIMEQNKHQDLPQLRSVTSMELGCDARGYSR
AGNTTLTWYCVVLSGRPSFQLNAMRETMRSVKNTLIDDSALDATSINVLPFPALAIDALK
ENRLTFAWLDGEVQSKYCFFYLYSEDSYETCGPRRYGDPTDVPQLFIIRYRRNSTENDLK
TEKKVKSIWDAFQEEDLHLASQLVAKYNGSNHIYEIIKWISKIIEDGDTRNLPYFTAKTP
ELIPEDKDPIWSSTLGVMPSTWGIKKRFQNTLKCVKDYMSDPRLGPIFMLGACISFGTIW
LRNSQTKPAEKVKGGSRIRRKRSSNLQHDRPSSITDTDPTDAYQLLPTDSDSD
Download sequence
Identical sequences A0A1D1Y2R6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]