SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D1Z4P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D1Z4P9
Domain Number 1 Region: 21-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-61
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 394-463
Classification Level Classification E-value
Superfamily HMG-box 0.0000000195
Family HMG-box 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D1Z4P9
Sequence length 482
Comment (tr|A0A1D1Z4P9|A0A1D1Z4P9_9ARAE) Putative LIM domain-containing serine/threonine-protein kinase DDB_G0287001 {ECO:0000313|EMBL:JAT61873.1} OX=1678845 OS=Anthurium amnicola. GN=g.29510 OC=Potheae; Anthurium.
Sequence
FTMSEWTEWIDEAIDKMHIKYFDYEQFRNIEEIGAGGFGSVFRANWKNSEQYLALKSLLR
LDAVSVKELVHELKLHREVDFHDNVIRFCGITREKNDDSKRYLLVMEYADGGTLQNYLAK
NFYNLSWKVKYNLAFQLAGAVLCLHDEGIVHRDLHSGNVLVRQDTIKLADFGLSKRIDDA
SKVPSKLFGVIPYIDPERFEFNTKKKYELNEKSDVYSIGVLLWVISSGQHPFHNKHHDIN
LVMEISKGLRETPISQTPKEYVKVYTECWSGEAKNRPSMKDVVSKLKTIITNSNIMTSNL
PQMDLSNSISDIIAISSINNSLHGELSKLMEDFNKVDFDSDANNNNDNNSNISNISNIST
IEKVINVLSTVDNADSVAKISVPFPPQITIEEILDRRKNDKLYSKAPNNFMIYRMAYAKE
LKNQNVSNINSFNISVLAASKWSSESLEVKQAYKDLSNKLQNRLEDIRNSNKISDSKNAN
TV
Download sequence
Identical sequences A0A1D1Z4P9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]