SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D2A7R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D2A7R8
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-33
Family PAPS reductase-like 0.011
Further Details:      
 
Domain Number 2 Region: 241-350
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.7e-20
Family PDI-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D2A7R8
Sequence length 354
Comment (tr|A0A1D2A7R8|A0A1D2A7R8_AUXPR) Uncharacterized protein {ECO:0000313|EMBL:JAT75250.1} OX=3075 OS=protothecoides). GN=g.52221 OC=Chlorellaceae; Auxenochlorella.
Sequence
ALATFGDTIGIAWSGAEDVALVEYAHLTGRPYRVFSLDTGRLNPETYRVFAAVEKHYGIK
IEYTFPDAQETMDLVRDRGLFSFYEDGHGECCRVRKVRPLRRQLAGLGAWVTGQRKDQSP
GTRQAVPVVQVDPVFEGASGGPGSLIKYNPLSNMTSTEVWNFLRVMGVPTNALHAAGYVS
IGCEPCTRPVLPGQHEREGRWWWEDAAAKECGLHSGNVVRSAEEQAAREAAAADLWQSGD
VAALSKEQLSAALEDVAGRGEPTLVVLYAPWCPFCQAMEPAYAELARQLAGSGVKVAKFQ
ADVEREFAATKFGLETFPTIVLLPQKTPGFIKYPSERRDVDSLKMWVKALTGGQ
Download sequence
Identical sequences A0A1D2A7R8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]