SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3JGE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3JGE0
Domain Number 1 Region: 240-516
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-39
Family Duffy binding domain 0.00001
Further Details:      
 
Domain Number 2 Region: 527-610
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000209
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D3JGE0
Sequence length 858
Comment (tr|A0A1D3JGE0|A0A1D3JGE0_9APIC) Duffy binding protein 2, putative {ECO:0000313|EMBL:SBT84907.1} OX=36330 OS=Plasmodium ovale (malaria parasite P. ovale). GN=POCGH01_00238600 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MFLNIKKNGYSSVIQVNYYKEKDILYILKRKLQNGKNNESNYFYSFFEKKHKLLVNIMEE
IDKYGKYCADGMNDILAKEHRKNGEKKIELFVQANDKNRKGKKEKIKVIKGTKKNDKEFN
GKRTSRQLEEKDDVIGNFRDKIYTGDKYGKDNLIKNGSNSDAYDSENINNKIPTGNQSQK
SLYDSREFVHIPDMLSSDEEHKVVATTDIHNDKIYTTTVPNYSFIDYPFLVGCKAKRNGI
WDCNKEDVNEERICIPDRRIQLCIYILMYLKHNDYSNNLKIRLLVSLNSEIILLLNKWNV
SGKFDNDAFCNDLRNDYADYGNVIKGTDMEGRDYSEEVELRFEEVFGNDDNGKRKRMEWW
YANKEDIWNNVLSLVKERANDITIEECTKEPNFEEIPQFQRWIQEWVTNSYGVRDKKLKS
LEGICEKENHSVRENGCNIGVECKKACLEYDKWKYEKKKQCYILLKKFSRVKDNEMFIQK
GSIDTISKILSKVCEEVNKVETNSTDNIYNNFCKCKASMGFFSERECKNDEECKRMCDAY
TSWIKQKIQERNALSQKFNIVKDTAKNAQGGNTENAPNFLVQVCKEFNWLDFEKIFDLSY
IIYKNVCNCKTVRNTKFFQLRMEGKKPEYTSTPSTVTYEALKLSGSKENSSNRTDSSSTT
NLSRSVLDIKNSDDAHSSYNESAKNAYDKECGPGTVNTRMRFENESINTSAMGTISNTEN
ENVDNYPNSAHTTVHFEGNNISTSMLINRDNGNELSKFSNINNLASDGDAHKTEVNKRSH
NNYNIIDKNNESADGMKCEHYTNQNGDHSSPFATGSLKERSIVNKALTGTVIGLTNINKE
EEKNVEKHNFSRSNTYDE
Download sequence
Identical sequences A0A1D3JGE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]