SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3JHC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3JHC0
Domain Number 1 Region: 114-221
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000405
Family Duffy binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D3JHC0
Sequence length 693
Comment (tr|A0A1D3JHC0|A0A1D3JHC0_PLAMA) STP1 protein {ECO:0000313|EMBL:SBT85714.1} KW=Complete proteome OX=5858 OS=Plasmodium malariae. GN=PMUG01_00053600 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MENCIPKNFALSGSAGFGLQHTQQFRTIRAHIQNKTNFLKTANNENSFKEECKQLADFLI
KNMSPPLYTSQRMWESLLKFHLHQYFKDITNYGGCPMILKKEHKELLELKYKEEDFCKKR
TRYLKEIENLKKTNSGKCETICLKKCKAYNAWIIEMQKQFEEKRNLFESCYKKGSPKKKS
KKQIPEPVCNILDQNTFKELSECITPNSVETTESLLETESKGLETQIQNTDQIISKSHVQ
QETDVQVIPEHQTEIESHISPQPPPEHIKSEVSEIKHSTKETEDSQSLADASLEAANSSE
DVHVASEVTDALLSPTLQDIQLSPDPENTQPTDKASTYTLARSPQISHTTEHTIYDDEEI
IKKIKINELTKNVNLSKRTRDRSKIIVEVHMEVLEEFRNKEWENIQDEFLEICIDEFTKE
DNITFPNLIDDDLIIENIKCISDIKKQNILWNKWIQRHRNLSQNLKKDDWFNNLKDEWKR
EVSYIQEMEEIKNKSSNENQKVSFLEREKDIWRQWISKKGMIIQQHLDQYWNNGLAQELQ
NISDEYVNEDTKNYVSLLNVEELNHKENNEELYKYIKKKLLTKLCILVLIAVLEECKKEV
NLENRESYLDRFINEWKGEGYSSKKQEITEIIIEYNNNDIENKRNEEFDAHTWKDCFRNE
IDDWIREDDLYANYIVSDRTVDKSDEIAEKPFL
Download sequence
Identical sequences A0A1D3JHC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]