SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3JI49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3JI49
Domain Number 1 Region: 61-178
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000942
Family Duffy binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D3JI49
Sequence length 704
Comment (tr|A0A1D3JI49|A0A1D3JI49_PLAMA) STP1 protein {ECO:0000313|EMBL:SBT85942.1} KW=Complete proteome OX=5858 OS=Plasmodium malariae. GN=PMUG01_00070100 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MDNCFSSKLNVQASGFFRFSHDSKFKKIIKYVTEKSSTLSKISDQETFRKGCLDLAKYLI
INKSPPVYYRDLKDMWEGAIKNWVKPHYEKLNIHGGCPVVMDENDMKILKLKYEQEDFCK
KRDTYLNEINQLKSKHLKKCNDDYLRKCSEYNVWINLKKTYFDNNKSLIQNCYNKQKPRG
NSIRKKGPALICDIMNHEIFNEPTDCLLSSTVVPCETSTKNKHEIEIRRTEVTSESPSMP
HVKKEENTQIAQEVQFGESEAIIQEEKPRNFQELSQLPSQEQTELPLQESTETITNKTAV
IQTENVPTSGGHTNFESSHNSTPQGMFKKKRKISRRHVKFLRLLVPSYSNKKSKIFTDDY
LEHTLYNDEKIIKKIKINEVTKNINSSKRKKDRSKIIVEVHMEVLKEYKNEEWEKNKDEF
LEICIYELEKKDFRTCHNLTDDDLIKKNITYNNYIKKKKFVWNKWIKKNRNLSEKVKKEN
WFHNLMIKWKRELEYIQEMEGFKKKSSNKNKKISFLEREKDIWKQWISKNGMIIEQHLGE
EYLRELTGTMHNISEEWVNDETTNYVSLINKEEFQNNGNYKELYKYIKKILLTNLCILVL
MTILEECKNEANFENRESYLDNSINELKEEDYSDKKQEITENIIEYNCNDLESARNKEMN
AHRGEHSFRNEIEDWIRGDGIHENSIVNDGTLDKSYKTIEKYIL
Download sequence
Identical sequences A0A1D3JI49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]