SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D3JM56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D3JM56
Domain Number 1 Region: 24-220
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000615
Family Duffy binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D3JM56
Sequence length 694
Comment (tr|A0A1D3JM56|A0A1D3JM56_PLAMA) STP1 protein {ECO:0000313|EMBL:SBT87646.1} KW=Complete proteome OX=5858 OS=Plasmodium malariae. GN=PMUG01_07011000 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MENCIPKHFTLSGMSGYSLTRREPFRTIRTYIQNKTNLLKTANNEDLFREECINLADYLI
GKMSPPKSVSPTMWEALLKFYLNHYFKNLTKYGGCPMILKNEDKELLGLKYKEEDFCKKR
TTVLKEIESLKQNNSGKCVSTCLDKCKTYNAWIKQMQKQFEEKKSLFKYCYTKESSKKKT
KKLTKESICDIMNEETFKELSECITPNSAESTEGLLETEKKGLETQIQNTAQIISKSHVQ
QEIDVPTAPEAQNEIESHNSPQPPPEHIKSEVSEIQHSTIETEDSQSLTDASLEKAKISE
YVHVASEDTTALPSPALQGTQLSPDPENTQPTDKASTYTLARSPPQISHTTEHIIYDDEE
IIKKIKINELTKNVNLSKRTRDRSKIIVEVHMEVLEECINEDWENHKDEFIEICIDEFTK
KDYTTYPNLKVDDLIIENIKCISDIKKQNILWNKWIQRHRNLFQNLKKDDWFNNLKDEWK
REVAYVQEMEEIKKKSSNKNQKVSFLEREKDIWRQWISKKGMIIQQHLDQYWNNGLVEEL
QNISDEYVNEDTKNYVSLLNVEELKHKENYEELYKYIKKKLLTKLCILVLIAVLEECKKE
VNLENRESYLDRSINEWKGEGYSSKKQEITENIIEYNNNDIENKRNEEFDAHIWKDCFRN
EIDDWIREDDLYANSIVSDRTVDKSDEIAEKPFL
Download sequence
Identical sequences A0A1D3JM56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]