SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5PAS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5PAS5
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-69
Family Nuclear receptor ligand-binding domain 0.00000000318
Further Details:      
 
Domain Number 2 Region: 57-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5PAS5
Sequence length 454
Comment (tr|A0A1D5PAS5|A0A1D5PAS5_CHICK) Hepatocyte nuclear factor 4 gamma {ECO:0000313|Ensembl:ENSGALP00000049839} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=HNF4G OC=Phasianidae; Phasianinae; Gallus.
Sequence
MMRVSEPILDMEMANYSEVLDPTYTTLEFETMQILYNGNDSSGEPLNMNATDSGISSLCA
ICGDRATGKHYGASSCDGCKGFFRRSIRKNHVYTCRFSRQCVVDKDKRNQCRYCRLKKCF
RAGMKKEAVQNERDRISTRRNTFDGCNIPSISTLSQAEALSRQISVSSPGASTDINAKKI
AGISDVCESMKQQLLVLVEWAKYIPGFCELPLDDQVALLRAHAGEHLLLGAAKRSMAYKD
ILLLGNNYIIHRNSTEVEISRVANRILDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGL
SNPVKIKNMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQLVKLFG
IVKIDSLLQEMLLGGTSNDASHLHHPVHPHLAQDPLTGQTILISSMSAPVHAEQISTPET
PLPSPPQGSGQEYKMSSNQASVIAQQSILKQKSL
Download sequence
Identical sequences A0A1D5PAS5
ENSGALP00000025225 XP_425924.4.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]