SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5PKW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1D5PKW7
Domain Number - Region: 137-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0102
Family Allantoicase repeat 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5PKW7
Sequence length 221
Comment (tr|A0A1D5PKW7|A0A1D5PKW7_CHICK) Chromosome 8 open reading frame 37 {ECO:0000313|Ensembl:ENSGALP00000053480} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN= OC=Phasianidae; Phasianinae; Gallus.
Sequence
MADELDQLLDEVERRFCRMPDRGATGGGQNGDRERAAAEDRSAKTLMGAGSDEDDIDDII
DEICNDSSSFARTPLKLKSNSPSVTPGSNSTVVQAQRKRCCPVYLGGSSSPNGIGTNISK
RTCDQLRCTACDFCVSLFNDYIWDQSCDYLFFRNNMPELSKLRAKMIKKKGSRAYACQCS
WRSIDELTDLQADQQLRYWCHLGDSYFTFCAGSVNVVRANV
Download sequence
Identical sequences A0A1D5PKW7
ENSGALP00000025719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]