SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5PQR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5PQR8
Domain Number 1 Region: 27-143
Classification Level Classification E-value
Superfamily C-type lectin-like 4.19e-16
Family Link domain 0.018
Further Details:      
 
Domain Number 2 Region: 133-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000445
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D5PQR8
Sequence length 618
Comment (tr|A0A1D5PQR8|A0A1D5PQR8_CHICK) Sushi domain containing 5 {ECO:0000313|Ensembl:ENSGALP00000055235} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=LOC420721 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MALGSRRSSLTFARAVGPVFFILQIISVRADGKVFALQSKNNSQGLDLAEAEKACVDLSA
RLATAEELKRAVLDCSFIGCTTGWLADGTAGTIICRKTGSKQQSVKAIDVKIETDPFVND
QYDAFCVKDEDKPCGDPPSFPHTILHGHTGFEMGDELLYVCAQGYVMGNKETAFTLLCDS
CGEWYGQVQACVKDETEAHIDYEDNFPDDRSIPIAENEHANGKEEIEQEQLSFSKKSEEG
RTGSTKGVTQDIDTSEKGSRAPTESPVSLLSQKNLFWFPSEAFSEPESEKGTDDSTKAHF
SEGDNHIGVKTVYDEPGAKMFYDSEDFPIGPILTANDTKEEIDAVPITDESWLDGYPVTQ
EVVEDDEEEGDKVDGSMGTEEDIILTTDQPNHVEVRKLGDGSPAPEEGLTQIVAATTSID
DERVKETPVPLTSVSGLEDLSVSRGYDDAAWDHPTTALETVTQEPVTTVLLDITSLRTSV
SETSVMASPFDHTTEEEAKGTTAYPAQVATTAPAPDIPTDTSSPELDEQENLTQGLGEKP
VPTSEPCEGEDCPRSSKGAVIAVIVILLCLLLAAAVLAVWFFKKRQQKNSVYKLNGRCQP
RHHCYHHYHHQHIEMQKV
Download sequence
Identical sequences A0A1D5PQR8
ENSGALP00000019506 XP_418822.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]