SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5PUW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5PUW8
Domain Number 1 Region: 1127-1303
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 689-804
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.92e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0019
Further Details:      
 
Domain Number 3 Region: 469-581
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-23
Family Pleckstrin-homology domain (PH domain) 0.000029
Further Details:      
 
Domain Number 4 Region: 897-1041
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-18
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1437-1549
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-16
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 6 Region: 591-704
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000617
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 7 Region: 21-84
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000103
Family SAM (sterile alpha motif) domain 0.00032
Further Details:      
 
Domain Number 8 Region: 1018-1119
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000712
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5PUW8
Sequence length 1700
Comment (tr|A0A1D5PUW8|A0A1D5PUW8_CHICK) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSGALP00000056726} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=ARAP2 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MTVRANIRNEAAIMSSTGSDIDIEEFLVNINLGQYLPNFKEHGYNVVTDCVGINNSALQQ
MGVLPTGHRRRILKQLDTALSKMQGNSLPRDNLKLKVLQGLEKKQYSFSDEDSPVSHLNV
DESGLIPATSLVQLPNKAYIGKERSRLGEQYLLEANDESFTNSDFPSLYRGSDSVLKTVS
GSMKMNTESNTLLEKAAAYQTDEHLADCVAFCDPLSLTHSYETKYKENKHQMFAVEEDLC
DSEPHSPFVKFKGEMIDNDLYDSCTQNCVKVFPRTSRSFILRHRPVPEIPESSKVDTSSS
SLQKRRNVDLIDVSCAGRQVSQKKTSSEEKPPVISPYGETYFWDNLKDAKELHRNEFLAC
ENKSDLEMPEEYSSNKNICSLNNQDEKTKECVKNESLSQENKSLPPEDFESEPVYSIVDQ
CSFSSKKNKNKTQTHSSSCSKNQSGKSNWLVSEQMDSQQFDGGQTSIANESIAPYACFYG
SSVKKVKAGWLDKLSPQGKRMFQKRWVKFDGDSISYYNNEKEVFSKGIILLSAIATVRVH
GENKFEVVTSHRTFVFRVDKEEERNDWVNKILNAVKSQSDNNPQSRISVAPEKSGYLELK
GYKAKIFILLQGNTVWICKNEQDFKTGFGITLIPMNVANVKQVDRAAKPSFEIITPYKSF
SFTAESEREKQDWIEALQQSIAETLSDYEVAEKIWFNESNRSCADCKAPNPDWASINLCV
VICKKCAGQHRSLGPRDSKVRSLKMDASIWSNELIELFIIIGNKRANSFWAGNLPPDEEL
HMDAPAEKRIAFITQKYKEGKFRKTPFPYKTKEQLNKALCAAVVKQDVLETLMLLFSGAD
VMCATGDPVYSTPYLLAKKAGQRLQMEFLYHNKFSDFPNYDTSFESGFSEDSSHSTFLCE
FLYKVSSNSTKLLTEKKLKEDCNKRWCTLESGFLSYYENDKATTPNGMLDINEVICLVVH
NSEYFLNRGDIFTFEIYLMSERVFLFGAETAYSQRKWTWAIAKHFVPPVAECLLERDCDL
IGQLYYKDCHNLDQWRKGWFAIEKSSLHFCLEMENAQEDSIYLRRLQELTISSVMQNGEK
IDVLLLVEKGRTLYIHGHTKLDFIVWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIA
FVTQYGLGSKHIYLKNGNSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQID
DAILTKELYPFWISALDMQNEKERVMKYGAFIRTLPPVNKATLAALIEHLYRVQKCSEIN
HMNPHNLALVFSSCLFQTKGQTSEEVSVIEDLIKNYVQLFDVNEDQVKQMDIENSFITRW
KDTQVSQAGDLLIEVYVERKEPDCSIIIRVSPLTEAEELTNDILGIKNITPNKDDIWATF
EVLENGELERPLHYTENVLEQVLHWSSLPEPGTAYLIIKRFLTADMMKLYNERNVKGSVK
AGYLKYKEEPSKLLSGNKFQERYFVLREGNLLLYKDMKASKPEKVLPVNSLKLYLGVKKK
MKPPTNWGIVAISEKHQWHICCDGQEAQIDWMISIFTAKHANIWPPAGKARKQSITKSPK
IGGLQLIPIQQEKNTCKIRGSTEDIQLRLGKPKCDEHNEVDLVEERKNLKEKASIVAQCL
ERKEEKVQNHAKTHRSFVSVEDMGVGMADLRQRSHKPPKKAKNKTNKTTLELDNKLPSNV
IQELNTVLQKNRILHDETSS
Download sequence
Identical sequences A0A1D5PUW8
XP_015141171.1.86415 XP_426346.5.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]