SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5Q7M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5Q7M2
Domain Number 1 Region: 126-225
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-18
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 2 Region: 239-331
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000825
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  A0A1D5Q7M2
Domain Number - Region: 30-82
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00236
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5Q7M2
Sequence length 420
Comment (tr|A0A1D5Q7M2|A0A1D5Q7M2_MACMU) Interleukin-5 receptor subunit alpha {ECO:0000313|EMBL:EHH16222.1, ECO:0000313|Ensembl:ENSMMUP00000044038} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_11475 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MIIMAPVLLILLGATEILQADLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHA
PPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQIN
PPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRQWFLIVLMATICFILLILLL
ICRICHLWIKLFPPIPAPKSNIKDLFVTANYEKAGSVETEIEVISYIEKPGVETLEDSVF
Download sequence
Identical sequences A0A1D5Q7M2 C3VEW9
ENSMMUP00000002467 NP_001274656.1.63531 9544.ENSMMUP00000002467 ENSMMUP00000002460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]