SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5Q8E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5Q8E2
Domain Number 1 Region: 151-524
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.8e-96
Family Phosphonoacetate hydrolase 0.061
Further Details:      
 
Domain Number 2 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000183
Family Somatomedin B domain 0.0031
Further Details:      
 
Domain Number 3 Region: 100-141
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000068
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5Q8E2
Sequence length 662
Comment (tr|A0A1D5Q8E2|A0A1D5Q8E2_MACMU) Ectonucleotide pyrophosphatase/phosphodiesterase 3 {ECO:0000313|Ensembl:ENSMMUP00000044310} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ENPP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MESMLTLATEQPVKKNTLKKYKIACIVLLALLVIMSLGLGLGLGLRKLEKQGSCRKKCFD
ASFRGLENCRCDVACKDRGDCCWDFEDTCVASTRIWTCNKFRCGETRLEASLCSCSDDCL
QRKDCCADYKSVCQGETSWLEENCDTAQQSQCPEGFDLPPVILFSMDGFRAEYLYTWDTL
MPNINKLKTCGIHSKYMRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNKNFSLS
SEEQNNPAWWHGQPMWLTAMYQGLKAATYFWPGSEVAINGSFPSIYMPYNRSVPYEERIS
TLLKWLDLPKAERPSFYTMYFEEPDSSGHAGGPVSARVIKALQVVDHAFGMLMEGLKQRN
LHNCVNIILLADHGMDQTYCNKMEYMTDYFPRINFYMYEGPAPRIRALNVPHDFFSFNSE
EIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVRIDKVHLFVDRQWLAVGSKSNTNCGGG
NHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFENIEVYNLMCDLLRIQPAPNNGTRGSLNH
LLKVPFYEPSHAEEVSKFSVCGFANPLPTDNLSCLCPHLQNSIQLEQVNQMLNLTQEEIT
ATVKVNLPFGRPRVLQKNVDNCLLYHREYVSGFGKAMRMPMWSSYTVPQLPSIELLIANM
ML
Download sequence
Identical sequences A0A1D5Q8E2
ENSMMUP00000023101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]