SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5QA40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5QA40
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 469-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 431-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 510-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000175
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-256
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000889
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 8 Region: 372-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000758
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5QA40
Sequence length 681
Comment (tr|A0A1D5QA40|A0A1D5QA40_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000044908} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=TIGD7 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASGPSPQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRETEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLVSHSQVRRSQAPRWGQGERLWDPSVQSCKEGPEPQRREEKFENL
EEGVPSVSSENTHPQVLLPDQARGEVPWSPELGRPRDRQQGDWAPPPEGGMEQALAGASS
GRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCSEIFGGNPRFL
SLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRHQR
THTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTHER
ERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGEKP
YKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCS
ECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences A0A1D5QA40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]