SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5QRQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5QRQ9
Domain Number 1 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000001
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5QRQ9
Sequence length 252
Comment (tr|A0A1D5QRQ9|A0A1D5QRQ9_MACMU) Amphiregulin {ECO:0000313|EMBL:EHH25923.1, ECO:0000313|Ensembl:ENSMMUP00000050737} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_15787 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRAPLLPPAPVVLSLLILGSGHYAAGMDRNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSELSSGVDYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVHLRKRYVRKYEGEAEERKK
LRQENGNVHAIA
Download sequence
Identical sequences A0A096MTK2 A0A1D5QRQ9 A0A2K5MEE2 A0A2K6CRT4 G7P5K2
ENSPANP00000003136 ENSMMUP00000003091 9544.ENSMMUP00000003091 XP_005555117.1.63531 XP_011732036.1.29376 XP_011895823.1.92194 XP_014994018.1.72884 ENSMMUP00000003091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]