SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5QWF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5QWF5
Domain Number 1 Region: 906-1216
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.08e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000543
Further Details:      
 
Domain Number 2 Region: 1174-1475
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.5e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000148
Further Details:      
 
Domain Number 3 Region: 414-613
Classification Level Classification E-value
Superfamily Fibronectin type III 6.21e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 4 Region: 2-114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-25
Family MAM domain 0.0000273
Further Details:      
 
Domain Number 5 Region: 312-447
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000199
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D5QWF5
Sequence length 1480
Comment (tr|A0A1D5QWF5|A0A1D5QWF5_MACMU) Protein tyrosine phosphatase, receptor type U {ECO:0000313|Ensembl:ENSMMUP00000052385} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PTPRU OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAV
WNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDILLLSYPCAKAPHF
SRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQVSGSGDLGWGRGGGLVAASGTDSLQDA
ESLLRTPAPRTASQPSPSSALPSLGPPFPRSECGSRNLCLRCVVGTAKWGPGQSEIGTPR
FEAPLTLSLSSLQRQSGALVPAAGVRHISHRRFLATFPLAAVSRAEQDLYRCVSQAPRGA
GVSNFAELIVKEPPTPIAPPQLLRAGPTYLIIQLNTNSIIGDGPIVRKEIEYRMARGPWA
EVHAVSLQTYKLWHLDPDTEYEISVLLTRPGDGGTGRPGPPLISRTKCAEPMRAPKGLAF
AEIQARQLTLQWEPLGYNVTRCHTYTVSLCYHYILGSSHNQTIRECVKTEQGVSRYTIKN
LLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDVPGGIAAESLTFTPLEDMIFLKWEEPQE
PNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVFSNLHPGTTYLFSVRARTG
KGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLRPAQGRGAPISVYQVIVEEE
RARRLRREPGGQDCFPVPLTFEAALARGLVHYFGAELAASSLPEAMPFTVGDNQTYRGFW
NPPLEPRKAYLIYFQAASHLKGETRLNCIRIARKAACKESKRPLEVSQRSEEMGLILGIC
AGGLAVLILLLGAIIVIIRKGRDHYAYSYYPKPVNMTKATVNYRQEKTHMMSAVDHSFTD
QSTLQEDERLGLSFMDTHGYSTRGDQRSGGVTEASSLLGGSPRRPCGRKGSPYHTGQLHP
AVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKKKDKVKGSRQEPMPAYDRHRVKL
HPMLGDPNADYINANYIDIRINREGYHRSNHFIATQGPKPEMVYDFWRMVWQEHCSSIVM
ITKLVEVGRVKCSRYWPEDSDTYGDIKITLVKTETLAEYVVRTFALERRGYSARHEVRQF
HFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTGCYIVLDVMLDMAE
CEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDAILEACLCGETTIPVSEFKATYKEMIR
IDPQSNSSQLREEFQTLNSVTPPLDVEECSIALLPRNRDKNRSMDVLPPDRCLPFLISTD
GDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPDFWRLVYDYGCTSIVMLNQLNQSNSAW
PCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARVFRVQNISRLQEGHLLVRHFQFLRWSA
YRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLNGGGRSGTFCACSTVLEMIRCHNLV
DVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYLEGLESR
Download sequence
Identical sequences A0A1D5QWF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]