SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D5R1C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5R1C6
Domain Number 1 Region: 78-191
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 286-400
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000157
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 489-526
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 199-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 245-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 450-487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5R1C6
Sequence length 805
Comment (tr|A0A1D5R1C6|A0A1D5R1C6_MACMU) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSMMUP00000054110} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=LRP3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAISRTVFPPAPAAAFPLEGEASQSSRSRPGAVAGACNPSTLGDQDRRITPDPFFVSPTV
NIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMIT
ISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASS
SGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNAVDECGDGSDEGNCSAPAS
EPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGSF
ASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTL
SYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSDGGS
AGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPD
GADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGS
LVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPV
EDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRVPRGQIPLL
TAARPSQTVLGDGFLQPAPGAAPDPPAPLTDTGSPRVAGDGPPSAPSHAPEVGPSGPPLP
SGLRDPECRPVDKDRKVCREPLADGPAPVDAPREPCSAQDPHPQASTASSTLGPHSPEPL
GVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences A0A1D5R1C6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]