SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5R5P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5R5P8
Domain Number 1 Region: 55-630,663-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-292
Family Motor proteins 3.99e-16
Further Details:      
 
Domain Number 2 Region: 857-982
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.41e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 977-1093
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.72e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1263-1370
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.02e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1081-1172
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000235
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1535-1649
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000828
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1370-1471
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000214
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1780-1881
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000577
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D5R5P8
Sequence length 1981
Comment (tr|A0A1D5R5P8|A0A1D5R5P8_MACMU) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSMMUP00000055636} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=MYH9 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDEMQSTQRAYFYHRFPILHLEPVDRIIGLDQVAGMSETALPGAFKTR
KGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLE
GIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQS
KVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAY
LKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLM
AEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKK
KMQQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLED
RIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTD
LSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQED
LESERASRNKAEKQKRDLGEELEALKTELEDTLDTTAAQQELRSKREQEVNILKKTLEEE
AKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQG
KGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKL
TKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQI
ATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQ
QELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKAL
SLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKT
QLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELE
DERKQRSMAVAARKKLEMDLKDLEAHIDSANKNREEAIKQLRKLQAQMKDCMRELDDTRA
SREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGAL
ALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENA
RQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRR
TEKKLKDVLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRE
LEDATETADAMNREVSSLKNKLRRGDLPFVMPRRMARKGAGDGSDEEVDGKADGAEAKPA
E
Download sequence
Identical sequences A0A1D5R5P8
XP_015005719.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]