SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5R5S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5R5S0
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 395-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 474-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000159
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000017
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 8 Region: 336-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000674
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1D5R5S0
Sequence length 645
Comment (tr|A0A1D5R5S0|A0A1D5R5S0_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000055658} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=TIGD7 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASGPSPQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRETEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLGEEKFENLEEGVPSVSSENTHPQVLLPDQARGEVPWSPELGRPR
DRQQGDWAPPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQR
IHAAERLCMGVDCSEIFGGNPRFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTG
EKPYQCNICGKCFSCNSNLHRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPY
KCPECGKSFSRSSHLVIHERTHERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECL
TCGKSFRQGMHLTRHQRTHTGEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGD
SFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences A0A1D5R5S0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]