SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5RDU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5RDU3
Domain Number 1 Region: 347-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-17
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000786
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 223-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000474
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000002
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5RDU3
Sequence length 557
Comment (tr|A0A1D5RDU3|A0A1D5RDU3_MACMU) Zinc finger protein 195 {ECO:0000313|Ensembl:ENSMMUP00000058486} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZNF195 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTLLTFRDVAIEFSLEEWKCLDPAQQNLYRDVMLENYRNLFSIGLTVSKPGLITCLEQRK
EPWNVKRQEAVDGRPAMSSHVTQDLLPEQGIQDAFPKSILRGYGNCGLDNLHLRKDWESL
NECKLQKDYNELNQCSSTTHSKIFQCNKYVKIFNNFSNLHRHNISNTGEKPFKCQECGKS
FQMFSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEHENIDTGEKPYRCQECDKVFKTC
SVLTKNRIYAGGEHYKCEEFGKVFNQYSHLTEHERGTEEKPCKYEECSSVFISCSSLSNQ
QLILAGEKLSKCETWYRGFNHSPNPSKHQRNEIGGKPFKCEECDSIFKWFSDLTKHKRIH
TGEKPYKCEECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSLSNHKRTHSEEK
PYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKC
EECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCEKCG
KAFTQFSHLTVHESIHT
Download sequence
Identical sequences A0A1D5RDU3
ENSMMUP00000029136 XP_001096863.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]