SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5UXB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5UXB3
Domain Number 1 Region: 28-219
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.7e-43
Family PAPS reductase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 289-398
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.03e-21
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5UXB3
Sequence length 400
Comment (tr|A0A1D5UXB3|A0A1D5UXB3_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_2DS_TGACv1_177565_AA0580190.3} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MASATASVSSHSSALRDLKAARIGAVRQQELVGASPLEIMDRALDMFGSEIAIAFSGAED
VALIEYAKLTGRPFSVFSLDTGRLNPETYELFDKVEKHYGIHIEYMFPEASEVQDLVRSK
GLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRASIPVVQVDPSFEGL
HGGAGSLIKWNPVANVDGKDIWTFLRTMDVPVNTLHAQGYVSIGCEPCTRPVLPGQHERE
GRWWWEDATAKECGLHKGNIDREDQAPKVGVNGNGSAEARAPDIFQSQAIVNLTRPGIEN
LLRLENRAEPWLTVLYAPWCPYCQAMEASYVELAEKLSGSGIKVAKFRADGEQKPFAQAE
LQLQSFPTILLFPGRTVKPIKYPSEKRDVQSLLAFVNSLR
Download sequence
Identical sequences A0A1D5UXB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]