SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D8NMJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D8NMJ0
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-81
Family Calponin-homology domain, CH-domain 0.0000396
Further Details:      
 
Domain Number 2 Region: 251-370
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-23
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 473-604
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000171
Family Calmodulin-like 0.0098
Further Details:      
 
Domain Number 4 Region: 372-478
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000309
Family Spectrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D8NMJ0
Sequence length 616
Comment (tr|A0A1D8NMJ0|A0A1D8NMJ0_YARLL) Uncharacterized protein {ECO:0000313|EMBL:AOW06813.1} KW=Complete proteome OX=4952 OS=Yarrowia lipolytica (Candida lipolytica). GN=YALI1_F10938g OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Yarrowia.
Sequence
MSLPQWIATQHKAFLRWANTYLEANQIGTMVSLETDFCDGVRLCQLIEIIGKESLGRYSG
QPRMRFQMIENVNTALAFIRHRGVQLHNIGAEDICDGNLKLILGLLWILILRFTIEDISE
EGLSAKEGLLLWCQRKTAGYKGVAVKDFSGSWSDGLAFCALLDKHRPDLIDFAQLDPTKP
RENMELAISIATEQIGIPQILDVEDICGVAKPDERSVMTYVAYWFHAFSALDMIENAGRR
LEKFVEMTSSAYAMQSGYEERMKALLKAIATQKEKWEQAADPEHLAYVEVKQQTAEHATF
KIKTKREWTREKASLASLLGNIRTKLATYNLKEYSPPVGLRSADVEAAWKELHMGEINRS
KLLNQSMRRLKESLRKRFADAANEFSDRLSVLSTAISQMDGPLEDQLEEIADISEKLRPL
TEKIRLLKELDTSCVEANVEENDYTVYSYDELEYDLGLAKESVKKKLAFIENQIVARNMT
NLTPIQLEEFESVFRHFDKSQHNALLESEFSGALASLGLVYSETEMHEVFQAASEGQVSV
SFEQFITFMVEVTEDQLSAEQVLQSFAEVADGKMYVTELDLQNSLIPEPMIDQLKDTMPK
TADGFDYIAYMERLTL
Download sequence
Identical sequences A0A1D8NMJ0 Q6C2I6
4952.Q6C2I6 XP_505126.1.88470 gnl|GLV|YALI0F07601g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]