SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D8PR08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D8PR08
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.69e-27
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D8PR08
Sequence length 123
Comment (tr|A0A1D8PR08|A0A1D8PR08_CANAL) Grx1p {ECO:0000313|EMBL:AOW30570.1} KW=Complete proteome; Reference proteome OX=237561 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). GN=CAALFM_C702070WA OC=Candida/Lodderomyces clade; Candida.
Sequence
MSSILAWGFNLWYQPPPPTAQTEKEIEHTINSHKIVIYSKTYCPFCDQTKHLLNEQYPQE
SYEVINLNILDDGLTIQNQLYANTGQYMVPIIFINGQHVGGNSEVQQLHTNGKLQELLNP
QKY
Download sequence
Identical sequences A0A1D8PR08 C4YTR2
CAWT_05557 5476.CAL0003068 CA4963 XP_721348.2.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]