SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E2SKX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E2SKX5
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Cgl1923-like 3.92e-74
Family Cgl1923-like 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E2SKX5
Sequence length 309
Comment (tr|A0A1E2SKX5|A0A1E2SKX5_LEIXY) Uncharacterized protein {ECO:0000313|EMBL:ODA90371.1} KW=Complete proteome OX=59736 OS=Leifsonia xyli subsp. xyli. GN=ATY41_01665 OC=Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Leifsonia.
Sequence
MRDPGELFELTSALEVPDGLPLVAGLTGFADAGSGVSQLGTYLLATLHSEVVATFDADIL
LDYRARRPIIYFDQDHLDGYQPSTLKLYLVYDELRQPFLLLSGFEPDFRWEAFTEAVLGL
MERFRVKSVTWVHAIPMPVPHTRPIGVTVSGNRAELIEAMSIWKPQTQVPANALHLLEFR
LQPLSYPIAGFVLLIPHYLADAEYPAAAITGLESISAATGLIFPTDRLREDDRQFVANIN
EQVAGNAELGRLVGTLENRHDSYMEDNQPRSPLTDRDGELPSADEIAAELENFLAFRRHG
DEDNSRGDR
Download sequence
Identical sequences A0A1E2SKX5 Q6AFG1
gi|50954701|ref|YP_061989.1| WP_011185880.1.68452 WP_011185880.1.84704 281090.Lxx10170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]