SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3AZU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3AZU3
Domain Number 1 Region: 1121-1179
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000314
Family SMI1/KNR4-like 0.0061
Further Details:      
 
Domain Number 2 Region: 468-553,966-1003,1032-1085
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000038
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3AZU3
Sequence length 1237
Comment (tr|A0A1E3AZU3|A0A1E3AZU3_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:ODM14184.1} KW=Complete proteome OX=1432052 OS=Eisenbergiella tayi. GN=BEH84_01906 OC=Eisenbergiella.
Sequence
MGAWGIKALERDEGLDVLDILKNEYVPEHPVMDLGEMIELMKEEVMLGSDFSQIDFLFDN
TAMALAELYFQWKDNGKLDYDHEEAIWDKVTGFTASKEALAFLLRQLTDIKNEVPDEDGI
REIMDLWKNEDSGEIAPAWLEHLNQLIDRLDSEQEARQMYIKKYWGNFIGGSDDSLNLVA
FLEDQKKEEIPLSEIFAKIGLDKQNWDFRQTVEYLEFTHSDGVEMDFHFAIDVVTDLAAI
LLECSVSGSVNLQDLDEYNTPIRRIRITATPEEHEAMDKALADFAQSPLTYDLHEMMDDE
EIQEMAHHVEALRKELYEAAGRNRDYHVKAEDVKSLLPDWKGADGCIATNRITVEGRKVG
YCYREIPDGNWDSGWRFTAGDESDEYMDDPNNAGIYKLNTICNDDPDIISLLNTPAPCAF
ERDENGVFQQIKDWKPDEDEEDPDMDILKQCQKWHEESKQHKIIDALEAIPAEERTPEMD
SELARAYNNLADPHKPTCKEMLKKALALLKPHEEYFEDDYYWNFRMGYSYFYLDQEGRAL
RYFEKALEVRPGDDDTKEFIDRCKQGISLPQFWECFRERTENWWETFAEMEAELRQMMDE
DKDHTRGAELVAQMEDTLNLVFDEISFELGFNGEKHELILTPEGNKVKLFELVYFQKHAP
KEVLEHWNILVGRQPSQNIGLRTDDSWDISGEDVQIWLEEQGENSFNISAYCEKLLPMLR
EAEGRVWWMLTTLTDQILGEIPHMRYIDSFDVLEEPKAEPSFLLSQLPDKLREQGLELST
DPEAYLESYLGYEMKPNEDPNADWRLDVMAGSTCCVPLINGYLNADNDFMDDLHADGAVA
GFFCYPLDTLREEEGSEKIFDFRDKLEELFTTVDGSEMLALIGGATGLYCGYVDFIAWDI
REALNMAKEFFEGTDIPWAIFHTFRREAGSVPLKQQDDGTETENQDDELDETLTGMDYIP
YTQQDAEAFFAQLEQWNDEDEYTRCIQALNAIPEDWRNYRTAYALARALENYAIIGDHDE
GTLKFKRDKALQRAIEVLESVREEGQDKAEWNMRMAYGYQYLYGQEEKAIPYAQRWAELD
PEDENAPAVIRECKAEIRKRQRSRKKKAKFVPGDTPFEGFDLTNFWDDNWYALKEYVSDP
PSDELIASVEEELGYKLPAAYIWLMKQHNGGIPVNTCYPCDEPTCWSDDHVAITGIFGIG
REKSCSLCGEIVASAILHSFASDDMERNCASSACLVR
Download sequence
Identical sequences A0A1E3AZU3 S2LJU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]