SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3BAB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3BAB4
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.95e-19
Family FAD-linked reductases, N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 180-295
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000134
Family Glutathione peroxidase-like 0.0029
Further Details:      
 
Domain Number 3 Region: 1-53
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000102
Family PHBH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3BAB4
Sequence length 333
Comment (tr|A0A1E3BAB4|A0A1E3BAB4_9EURO) Uncharacterized protein {ECO:0000313|EMBL:ODM17887.1} KW=Complete proteome; Reference proteome OX=573508 OS=Aspergillus cristatus. GN=SI65_06675 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MARFYVDISSSNSRPQDPTTLFNDMVSRIRGILKPYQIDFELCDWWSSYRIKQQLATRFS
DPKCCVFLVGDAIHTHSPKAGQGMNASIQDAWNLGWKLATCIKGRGYPALLTSYETERRP
VAQRLLSFDKKMLGCFRSFCKEESNGVEKEKDLEETIKEEHSSASGIEVVYRGLGFESIL
EAPEAAPCIRLGYRIGDFNVIRHADGYVHSLHHILPANGKWRAIVFPGDITQKEPKRRLR
HVGSALSQDDPDELPFLPNSLTMGVIAQCEAILIHASSRDEVKPLDLPVVFRHGANLWDG
IMIECLRMILVLLILTYTFRYMRSWVSLRLRAV
Download sequence
Identical sequences A0A1E3BAB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]