SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3C186 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3C186
Domain Number 1 Region: 198-568
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.51e-77
Family beta-glycanases 0.00000084
Further Details:      
 
Domain Number 2 Region: 43-184
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.25e-37
Family Cellulose-binding domain family III 0.00033
Further Details:      
 
Domain Number 3 Region: 585-656
Classification Level Classification E-value
Superfamily Type I dockerin domain 5e-18
Family Type I dockerin domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3C186
Sequence length 660
Comment (tr|A0A1E3C186|A0A1E3C186_9CLOT) Glycoside hydrolase {ECO:0000313|EMBL:ODM26988.1} KW=Complete proteome; Reference proteome OX=1848158 OS=Clostridium sp. Bc-iso-3. GN=A7W90_12625 OC=Clostridium.
Sequence
MAQKHSEKSLLSVLTISVFVISCLFGLITVNAGNTTEETALEGLSIHYMDGSLDERYQSM
RPYIIIHNNSGQSVDMADLKVRYYYTKEGATEETLLCFYTAIGSSNIFAEFHPELGYAEI
GFTSGAGVIKDGGNSGQMQLVLKKISNGYYDQTNDYSYDPSFTDYAEYDKMTLYYKDTLV
WGVEGPPPPPEPTPPPNDDDWLHVEGNLIKDSKGNTVYLTGINWFGFETDGANGFYGLNK
CNLEDSLDLMANLGFNLLRIPLSAELILEWKNGEYVETSFVSTYENPRLDGLSSLDILDY
TINHMKKNGMKVMFDMHGATKDSYQDNLWYNKDVTMEDFIEAWKWITERYKDDDTVIAMD
LKNEPHGKYSGPNIAKWDDSEDPNNWKRAAEIIAEEILAINPNLLIVVEGVEAYPMDGYD
YTNCGEFTTYCNWWGGNLRGVAHHPVTLSAQDKLVYSVHDYGPDIYMQPWFKKDFDINTL
YEECWYPNWYYIVDENIAPMLIGEWGGKLINDNNVKWLECLGSFIADKKLHHTFWAFNPN
SADTGGLMLEDWKTVDEEKYAIIEPTLWKRGLDHVIPLGGVTPETFKYGDVNGDFKATST
DLTLLKRYVLKQITEFPSPDGLKAADLDGDGKISSSDITILKRYILKTITIFPVEEKLGK
Download sequence
Identical sequences A0A1E3C186
WP_069195237.1.19738 WP_069195237.1.54604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]