SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3R002 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3R002
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily HMG-box 8.77e-20
Family HMG-box 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3R002
Sequence length 73
Comment (tr|A0A1E3R002|A0A1E3R002_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODQ83228.1} KW=Complete proteome; Reference proteome OX=984486 OS=Babjeviella inositovora NRRL Y-12698. GN=BABINDRAFT_21495 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Babjeviella.
Sequence
RPKNAFILFRQAKQLEVLIGSSSIIPNREVSRELGRRWRNLPFEEKQIWLKLAEEEKKAH
NLKYPDYKYQPKK
Download sequence
Identical sequences A0A1E3R002
XP_018988556.1.12885 jgi|Babin1|21495|gw1.1.881.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]