SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4B8Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4B8Y1
Domain Number 1 Region: 30-200
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1e-19
Family Atu1826-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E4B8Y1
Sequence length 241
Comment (tr|A0A1E4B8Y1|A0A1E4B8Y1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:ODT03328.1} KW=Complete proteome; Reference proteome OX=1660163 OS=Gemmatimonadetes bacterium SCN 70-22. GN=ABS52_10010 OC=Bacteria; Gemmatimonadetes.
Sequence
MPLALALLSIVGYLAPAAAAHVGDAVPCTTTEGAPLPLIERPSPAGSAPLVLLLTGDGGW
AHADEEVAQALRARGSAVVGVNMRAYLRTRRSPDEAARDLACVARAYSQAWRRDRIILLG
YSRGADIAPFAAARWPADLRARLAMVVLVSMSARANFQFHLVDLIRDVERPDDVALAPEI
ERLRGLNVLCVYGEDDRTTGCLAADTTVVRRVARPGGHRLTEGFDAIASLLAPALEAQPV
R
Download sequence
Identical sequences A0A1E4B8Y1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]