SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2JM80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F2JM80
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Phage tail protein-like 5.23e-48
Family Lambda phage gpU-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F2JM80
Sequence length 132
Comment (tr|A0A1F2JM80|A0A1F2JM80_9ENTR) Phage tail protein {ECO:0000313|EMBL:OFV11208.1} KW=Complete proteome OX=1581094 OS=Salmonella sp. HMSC13B08. GN=HMPREF3126_14745 OC=Enterobacteriaceae; Salmonella.
Sequence
MKHTDIRLAIIEALENNFGEDATFFDGRPVVFEEEDFPSVAVYLTDAVCTGEELDTDTWQ
ATLHIEVFLPAQVPDSELDEWMESRIYPVMADIPALGDLITVMATEGYDYQRDDDLGLWS
SADLKYSITYEM
Download sequence
Identical sequences A0A1F2JM80 A0A2J9ZHA7
WP_058667650.1.29396 WP_058667650.1.62044 WP_058667650.1.67650 WP_058667650.1.8528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]