SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2P8K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F2P8K6
Domain Number 1 Region: 58-320
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.89e-84
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.000000266
Further Details:      
 
Domain Number 2 Region: 327-622
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.4e-52
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F2P8K6
Sequence length 623
Comment (tr|A0A1F2P8K6|A0A1F2P8K6_9EURY) Methyl coenzyme M reductase alpha subunit {ECO:0000313|EMBL:OFV67021.1} KW=Complete proteome; Reference proteome OX=1839936 OS=Candidatus Syntrophoarchaeum butanivorans. GN=SBU_000314 OC=ANME-2 cluster; Candidatus Syntrophoarchaeum.
Sequence
MAKKKKKAGAKPASLEEVAEGYRDQLFHKVTEGTVISTELAYQYDPLKLKDQFMPVERQR
EMYKALHTLFEGEPMDTVDKQSYRHGGVQQSRSKRMWVEWGKKIAIERGIPQYNREMGIP
LGQRYYEPVLVSNTDYIVDYDDFSVYNNCAIQQMMDDMRKTVIMGLDVPHRVIQLRLGKE
ISPESMNLYMETIQHVLAGGAVVQEHMAETHPGLVTDAYAKIITGNPDLRDQFDRRWVLN
IDKEFHPTRAEPLNEMIGNRLFNTIRTHTLRVRMTNGAAVIRSAAIAVTMSFVAAYKLTG
ESVLSDISFATRHAQAIHMGLATWLSRTNAPNEPGGIPIGYWSDMCCAEKEMPNTPWLKV
VSIDRDMQLGKDLTQAVLESAAVGAQIDAVWYGIYMSGGVGFPAFAYLYLGNILDDWLNR
FTELCYYNFEGHERVPDTWDCAKGFGEIAALYLMETYEKYPTLQELHWGGAIRCFITSAI
SNSFASLLTGDSLMGMMVQNYVVSLLMKEGWLRTGFGGQEVQAHAGLPYGPSLRIEEGGL
PELRGANYPMFSYTATHTPGYVTGTYAAMIGRGSSWCASPLVKVAFADPDSTFDFKNVRL
CIAKGAAKEYEPAGERDLIRPAR
Download sequence
Identical sequences A0A1F2P8K6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]