SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2PDF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F2PDF7
Domain Number 1 Region: 177-444
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.06e-73
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000101
Further Details:      
 
Domain Number 2 Region: 446-732
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.54e-54
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F2PDF7
Sequence length 733
Comment (tr|A0A1F2PDF7|A0A1F2PDF7_9EURY) Methyl coenzyme M reductase subunit alpha {ECO:0000313|EMBL:OFV68676.1} KW=Complete proteome; Reference proteome OX=1838285 OS=Candidatus Syntrophoarchaeum caldarius. GN=SCAL_000352 OC=ANME-2 cluster; Candidatus Syntrophoarchaeum.
Sequence
MAEEIKLDPELLAKLCERKIRSWQTDNAELLKATRADLTEAERAELLEKMYDDEEALKKV
FQTMGNPQVAVGMEFTREGGDISDEEMKEICDRWGLTREEVDQICDELWISERDIATCPG
FLFGRGVPHPDQGDTPEAKDDPTQSIWYHRLMKTQMQLAMHEYGTYQRAMNESVLAKGFG
VEDVREETTEYPAGGISQVPEKLEYVKVSKEIEKQRGISLYRPHLHWHGIELGQKPYVKW
KITATHMQRPCRTFDGLSMEQINFLNNAACHQWMADVQRTHIFGLDLAHRTVERRFGKEV
TPDSINLYMEMHNHNIAAGSLIMEHIGETDPRLVADSYVKIITGNEAMLEVLDPQYIIDV
RQLFPEYQASQIMNQIGDKLFEVARIPTLITMIGDHGTTRGWTGQQASLAFLSAYRIPAG
EAVTSDFVYTVKHGDNIFMGNRLPWRRAKMVNNPGGVSFGYAADISQASRAPESQDPFDP
VNVFLESVAWSGYYDIGYLHNYLAGGSSGWTQVMITQGYCSDIDNDFCYRTLDADTMTHF
MGLDFAPTSMDSLYTATEGIVKYGMEYFDKMPIAQETLYGGLQRAALISAVGGASTAYFC
RTPTFGLPGFYHGLLLCKEGWNRLGFYASDGPHQQGTFHAYTLIGEYGGPLELRGPNYPD
YNWSVAHLGIYTAYVNGPHFLCGHGYSCNPIVHGAFADPSLLFDFAHVRREVARGAVHEF
MPAGERDVVIPAH
Download sequence
Identical sequences A0A1F2PDF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]