SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4GVV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4GVV0
Domain Number 1 Region: 312-437
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000127
Family UBX domain 0.048
Further Details:      
 
Domain Number 2 Region: 132-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000038
Family Thioltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4GVV0
Sequence length 455
Comment (tr|A0A1G4GVV0|A0A1G4GVV0_PLAVI) UBX domain, putative {ECO:0000313|EMBL:SCO66676.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVT01_070039000 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MDDRVRVFMEVTNLMDEEEAKSILNACQGNLEEAISTYLSKVDFERMGEAPPRNEGLRNR
GPSRYPPGAAANQPTQRSGVCQREEDQMERTNLYQVWNQVGSLLCPIMKNAYSLMSTCLK
MVSTYIVNSPQSANFTQYYEERFGRRHANFFQGSLSDAIRVSIQQGKLLLVYLHTENSNG
TYFCEFIFKNEEVKSFLDNSCVLFALDITKGDVRELGNVLNVCVLPQMNVIQTCYVKEFE
ELSIIYGNPSVSNILNTVANCIEMMNMKKASQSKEKDKTYTDRLLREEQDREYQEALRQD
QLRAEEKRRQEEEKKKKEEEKKKMMSQKKDVKLSRRERARRFPLPIKSNEKATRICVRLP
NGMKIQSNFSLNHTVEDVYEWAECAEFLRPDARGIKGGEITVPLRFQLICGHTKDVLQRT
RETLGEFDLYPSAVLNMKSLDAPSDGGSSAGMASE
Download sequence
Identical sequences A0A1G4GVV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]