SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4I0S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4I0S6
Domain Number 1 Region: 3938-4297
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.96e-114
Family Hect, E3 ligase catalytic domain 0.00000018
Further Details:      
 
Domain Number 2 Region: 3518-3593
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000316
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4I0S6
Sequence length 4304
Comment (tr|A0A1G4I0S6|A0A1G4I0S6_TRYEQ) Ubiquitin-protein ligase, putative {ECO:0000313|EMBL:SCU65221.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000016200 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MLAVRGRAGSFRNQGGMTFQGNEYHVTQQLQLLPPVLQRYVGRLHECLVDCRLTPQVFHE
ILNDEEFFRDVRGSYNKRFGDIIKTVAGEWWSTCMKDILQRVSSAADGVDNAPAASCSAV
RAANEETTEGTSSLDQVLPGKCDDEASSIEVCRDLRAVLLLAVVVCSPYCVIRGPDTPVI
TCTARVMLCRDPSIIYLGLLINLAQSNQAERSLDSAMVLRTLAHGWGSSPTFEDVVKCCL
RARRRRQRRLAAPNEEEQVNAISTEEDDAEEAADIALLQLPGLVRDPLQIVPDRSAAQSS
GGGGKCMSDSLHIGRCVLQSMASAAGNPERLLWWCRCRLLCMQLLSPADCEELLAGPSCD
FFRSLWKVERMFGDILDLAEHDDDGEESDACYGGISSTSGVGSAPTVAALVGIVADIVRG
WHRAENSGGAMGSIVLNYTSRNPFETVNRVVPGHRKFQQRSHRCLARDWQYGLLVQYHST
HLAVFPHPNSSYATMLPVMVAQLTDVLRHYPHYSPIQLMYSLALTRENTNTSVALNSGLV
PAIVTVMRTYMDEKQEYGENASADNGTEGIRYGWSYKAAGVLHWCFTVLEQLATLSTHES
VNPIVFLLSPAEEDGYELCHHICKKIFYPGGHPVLLVAAFRFFSACIHHNVRDVVPALQQ
RGVLDTLLKIGESTDILERYNCPRGEANSEEGVAVQQAGEGQPPLATSVKGNKVAPITLA
EYSAYYEQAVPIVCICSMLQAFAVHNSTHASLVNRMIMRRFVWSLTVPYFPEVSSPLSVP
SSPSTLAVLCVERVEPQRVFTRLAAAAGVDLLVLIRTLPPLQDYFFESVEETLKSLIEEA
KQKGPPLRDVGLSMWNILACFSDLEYKQLAQRGSGRRGRSQRADQASEAADALLDKFKNC
GKVVAGSLGTLLKLSSTVPFASPVSLLSNGNVLTSNLFDVQCMMFESLTREVIQFASDIV
KDALQGGNNGVLTEEQAGALWSLFFLFFRKTSHGSSSANGTNHFRRDLANVIFDAFIALE
MATGTQRTQEESAGSAVPALTPVAASPTVGDQVIGLMDAHSMWSSDFELSALANNLLSSA
LSMALPPSDRSPANTPLNFFAAVVDGANAGNDAFGVRHVDTTSADAERGNTETGPNAVSG
SSSAVERFRNDVSRLLTSSQTRHRHSLPTFHTHYHGSGVPLNPHTSGSGHIMLVAPSYIL
GGVRELLQKVAKSVTAAARVRKEEEDIKEEGDTSEAGCPPQKMQWEQMHHFAALEAVDLA
PLREAEMRLQAAEAALSVGWKYISGNSGLVAFLHNIIGNLWRITECLLPVQNSQLLTGPL
SSTSSALVNNPCNFCGVGGVAERGSAVATSDTTANSGATAGPPLDAEKLKTVVGYLTGIL
EALLKLPPDRGLQRFPWQPRLLYFALITWRSRGLELSPAMILGALAHLVDLGSEVFKRGA
TVISPSISACESEVDVEAVGDDRSPLTLGSPPRPDSHHPNRSEEDSMVRIRVAGDFADLF
GEVLPSVSLRSERLVQLSLRNRTSRSDTPVAPRTPEVSATGFPRDTEEWRGFGPVSLAEY
APCWVLEVAATMHANDKSVGKMWVLIRRLCSKLCWIYHTYSSPVSANSGAGDDDQPKKGI
LLIERIIRLVLEDPVRNYTLLEFLAVVLSQDETTAQREALVTRTQLPYAILDCIVKEVRR
IENEQNEDASKRKEKWSLRNSMLGQLFCFLSSCSVGALTEKGTGACPHYRGNSTSFCWMG
HLCPHPHVGDKSGSHMRRGSARSSKVTRQIAKVLEEFGYKGDVSPQAPPSELETVTSDAV
TGATSRRATGRNMRGTEAPGQNPAENARNDGDETATHQDDAVSGVSSVTKKCVDVKLKLS
SVVGGTSSLPKSMLSECAVLVLDYLADDDETNEAEKWESLNTEDTRSDTLCTPRHVARRA
AKVSGETNVLETPIICIAVALLAQLLDAGDTTLLSHIYKLNETSKKGFVMRAVSRLLRED
MIPTSVCVHVLKALVDQSDHTEWVVYSAMVSAVQNCIRAGVTVLLKETDVRDMYASSVLG
AGRKAIAPRVGGDVYRHSVPMDEFVTCLRTVVDKHPKAFCTVFNSACIVHIVSAEGNPKG
DTRSAVLLAPRKPPRIHAMGSAPSPQRTTVEYVLDTLLRRLAQKQLPPSFVAAVLNNITT
LPAVASIVTTYCVNVPVPESMRGAFLDQKAEEDEPTLNQKQEFGDSFLLHEATPRPLTPF
LAVLLFMDERQLECLEPFLSNVAQKAPSRMAHILLQALDVTLTALSSENSGGNCLVTRNE
EMELVHRASSRPSPRTMACSLLHALRLLLVVTSSSLVWRLCEELWQRGALDLLYRMVEQK
CYSTEKDAATLILVIRRLLLAHSKCAGRSNGKVSPAAGHGVTAGSSVSRGTMTGLQGAEL
SDAHLGLMRHRQRRQQQQSGAEEDEEDSQTPPPDTGREEGRTLGEAGMSPLPTGMQQPHR
QQFLQSGSVDDSFYLNALVNGNDSRREASDSNNRRRRSLEEGTFSGFLLGLGELLRPTQD
IVSFESRNISDSTHDEDESDVTGDGDIGGVSPGQQAIHLVVGRIGGGFTPRGSGDGDDNS
GHNEGGEGNIARGARSESGFDMSGVDDDDMGGNDDGGPHSDGGDDDDVEGADFDLNDTDD
DDDDDDDDDDDDDDDDDDDDDDDDDDEELLNFDSEYYDDEMERGSVSFSLHNRYPPGGLL
GGTGPQIPFDSFTVGNEPRMDGRPASIEAWDFSSVRRDQRIRLEDLHPHGEGWSLPSAVP
DPADFWSVFAHGRLEGADHMFHTLYGSSRHSSTSRLVNICSIVNMEVREQWESAQALHPV
RQVLRETSEAPPDPEVTPPAPEAAGEPRNGDETAAWNAGGDDITLIGGNGDTQPLLYEPG
HGEGQLQQQVNDRTGTDIATMAEANVAHVPGETATQGFSNSESSGATRILASPGSATDDV
GAGLALLDFGGQSVAPQADPAETHIASDAGVTSSVVASAGSALTAPPTAIAEPPMEEQPW
FNVIRPHFLLELPETLRRELLFDHMNVLLGSETRELEGHQTRIFAAFFTQLPADVQREAA
EVEQRWRQVTGDVPSSAGNETPSRSVLLDLLATVDTELRQEILATCDLGDLEEYPELLRE
ANRARQSRAVEAVSEGDASVPRQLRRREGALTVIRGRRPADAEGANAAVSVFGTDALSTL
TLPRIPPVLRRIRGLGPVAYHQHRDNSLSWFTSNMSGNHHPRNLGRRQNSRIRDESSDDD
NVNRRGYSSRGFAFITEAHLVSCIRAQQSRVVRDERVTPPPNRQNGAAGVENAVPAIPSA
ILKQLVELIWLSKASYSPLDRPTSSSTDLYVGSQLVQLLVTACRKPETAAEAMLFLVDTV
LERIPSTSYSLSHESVGSESSQTGPHGVTDSGRNALPTASLVTSTSGVGRAVGASVDVIR
DCGRVALRTLLVIGQLIERCRAAGLSVTTLPDSVYMKVTQSSAESPITAQEETTGSRLFK
KLVELVLRVPLPRVEAAFTRVLCRLNQQLQRLEEIAPVSRRAPRDVDLESQGDNVIFHLR
HPHPLRWQNLHRYPYVDSGYICNRCNTTFHTETVAFHCEMCRFDICPACSFVSLTVEEER
VRGRHWGYSLVSSKGTMEAALQLLRHPNCTDDMAQEVMEFFRRGIKESAHRDKGVAAANT
SAAIAMVERVIIDLANSITVEIHECVNALRAAFPHKVFQSFFLSATSNEDGNSGGTESQQ
WTAQEASVALSYMCLNSTSNKLLALFHPYAESHRPEPREVSLMWHAVQMYLAEVAFILQH
IQNRSSVLLPQAVLLLLSTFCQFHMAEPRRDSSASTASESVSSLSLEKTDTERFMLDSTH
ASSTVSDAADAAAKLANSEQRQHRDPPPHEGPDVGSTDSDGSGDERPMMPRVVRQFVERN
KLTINALIQYDPKVLEGGFKFLRSEPGFVDFNIRLNDFHRQISYASQGPRISLSINRGQC
LRDSFAQLSKLNNFHGSISVRFSGEEGADAGGLTREWFQLIAEEMVNDNYALFIHSREGM
TYQPNPLSGVNPLHLQYFRFAGIVVGMAVAHRVAIDVHFTRAVYRHMIGIQPTFGDLKSV
DPELYENLKWLLVNDVSDLGLFFTVSCEKFGVTEEVELIPNGSQVAVTNANKSQYVRLRC
EFCMTRQIEEQLQEFLKGFYAVIPRKEIRNFSAQELELVICGMPDIDVEDLRLNTTYDGY
TSTSLQIRWFWEVVAAMSKEDRANLLQFATGASRVPHGGFSNLESSNGSPQRFTVSRWAD
SAELLPQAHTCFNKIALPEYSSCEELRKKLMVAITLGSRGFTMT
Download sequence
Identical sequences A0A1G4I0S6 Q580G4
gi|72392385|ref|XP_846993.1| XP_846993.1.54365 5691.Tb927.8.1590 Tb927.8.1590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]