SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4IIS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4IIS5
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000704
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4IIS5
Sequence length 784
Comment (tr|A0A1G4IIS5|A0A1G4IIS5_TRYEQ) Myotubularin-associated protein, putative {ECO:0000313|EMBL:SCU72385.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000396100 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MNVLIGKRELFAFAERYSECRIKEYAELADGAILCSLFAAVFPNMRIRTATSQTHTRSQL
AHANWSALRKALSAVGIPPSLLNRERLQCGDAESGFSALVLFYFLFHLSRRSDFSAEFAA
DVSEELTEFLQSVDSIAALVAGGAMSLSAVPLPLQEQLRGAIMRTREGCGLPEGGKESGR
SCGDTGLDTACPSSVVLAVQMDGGDNENNEKTTSDDLKRPPSFSSPEKFAERKDDRVPQE
TGGNEREVHSGYSVCRKWKQDDRECEEAYDTIDHCDSCRGGDAGYRRMAAGVAEEVGDEL
MAPIFQQNRDLQELLMVKEKKCEELKAQNLELLGHLTKLRIQYSMEKALPWQGDDTANES
TKVEKGELLASEEVQHLRSVLQTTRSERRRLAAKDGVPIDELLGGIVDAETGEVIDVENE
ATLLNGVLADVLRDIPRDRREAQRCLWRIVSAFNVLEERLAVAVGTQKPNCERVKREANT
IFGDDGGECGSPASVFRPPTTPCTTAKLVESCDDSSMFDLKAPADPSLSPENIFSRLKEE
MILRQRRFERQLIQLHDNEARLQKRIHVLQNKICHLCQRSLERDLTWKSLCAAICEAERT
SLLVADAESEEAVERLLEQRNACYIRADEVSASLMRDQEEQGDALIMPGGHENDCHDVCE
TMKVLLESVTQDRDKLLKELEALQDVGETGRNQRTEHQQRLSKGDLRKSVRTLLQEEGHS
SNGEWFAQTSTFFPFASSPSKLVLKNSVSAAQQEDGRPLHGGRCPLPPGENLSALLSLPG
VIGR
Download sequence
Identical sequences A0A1G4IIS5 Q38BT3
XP_822565.1.54365 5691.Tb10.70.4370 gi|71747020|ref|XP_822565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]