SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4UVG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4UVG9
Domain Number 1 Region: 7-141
Classification Level Classification E-value
Superfamily Phage tail protein-like 9.42e-37
Family STM4215-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4UVG9
Sequence length 160
Comment (tr|A0A1G4UVG9|A0A1G4UVG9_9PSED) Gp37 protein {ECO:0000313|EMBL:SCW97537.1} KW=Complete proteome OX=1566241 OS=Pseudomonas sp. NFACC05-1. GN=SAMN03159424_05717 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTPTKTQTEQLLDAMLARLQADLGSELMIELFPENPLQYRLNHPRGAVLLAYGKSTFGQS
ESTDACFQARHWVLRLTLVFRQLNGKDGVVGHLDRIRTCLSGWYPPHANQACRPVAEHFI
GHHNGVWQYAQDFTTRTTHLQTLVPESGQRLTSAQFQEHP
Download sequence
Identical sequences A0A1G4UVG9
WP_092349416.1.41806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]