SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G7ANN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G7ANN8
Sequence length 533
Comment (tr|A0A1G7ANN8|A0A1G7ANN8_9ACTO) Uncharacterized protein {ECO:0000313|EMBL:SDE16077.1} KW=Complete proteome OX=1657 OS=Actinobaculum suis. GN=SAMN05421878_1032 OC=Actinobaculum.
Sequence
MPGQTVFTVPVPEARGPIPVTENSYPFSTMVHAREPLDLAEFGYVEEEYFLRGTANVYGF
SNSIQPAGTPAATTAATGTGADSAGQAKERPITVVEENVPYMTRVLIRRPADSDPKTAWV
SILNASQGYDIEDDWRRAWDYIISRRLTYVAVTAKPIQISALQTFDPERYADLTWGGKPK
QLDASAPDWNPFATLPENEEGLAWDVIAQVAAWLRSGTAPTTPEHVFLIGQSQSAVYTNT
YLTYFHQILKLAGGANPYDGYAPGVGGLYVKAINQRESGIPQTIGQAPDLSAPDDAEKAP
AFAIYLVAPAQIDVPVIAISSEADVSLYEGTPASFCLGDGPWRRHWHVLRTPHSDARSRV
IPNNSETQKAKRQARVTNPEFLAQVSPLPLEPVVTAAMAAIENWVQTGTPAAPSRWFTHH
GNQWEIRDGLLTGGIVIGMVAHPIADFLPGSPKNPVYGQMRLHSAASIRQQYASFADYQA
ACDAVDNELEAQGYLEPVGRNFLHNVQRELWDRAIDGAPAPLSSPQEIIDLES
Download sequence
Identical sequences A0A1G7ANN8
WP_074661193.1.32364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]