SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G8PVA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G8PVA5
Domain Number 1 Region: 299-364
Classification Level Classification E-value
Superfamily ClpS-like 0.0000113
Family Ribosomal protein L7/12, C-terminal domain 0.0079
Further Details:      
 
Domain Number 2 Region: 186-240
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000412
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G8PVA5
Sequence length 368
Comment (tr|A0A1G8PVA5|A0A1G8PVA5_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:SDI96444.1} KW=Complete proteome OX=445960 OS=Chryseobacterium jejuense. GN=SAMN05421542_2404 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKITLPNHWSDFIKTFAKKHKEDILYDVVRVFRTEEEIQERYDTHEFEEYLPDYIPVADD
SGGQVAIISKNNKDTKVYLSSYGVLQKELLEVLDRDLMHWMQGKFPFDRVQHVLSAADIE
KREKENSLLVQKVSSFPVITAFLKDPVCIEGLALPENYASVEHIYYFQDGYQYNSVEHKA
LVSDVPGEFKPSWIVLASNYFADPFFIDLNEAKQEFPVYFAWHGQGNWEPVKIAENLTEF
QNVLLQIQNVRFDKAGLIEYFDENIDLENPLWEEVYTSIEEEEECVSNSIETDEAMGSKA
NLYITDIGPNKMKVIALLKKEFSLSGTEALQLSKNPKILFRTGYTKWLEYDRKYLEDLGA
TVEFETLT
Download sequence
Identical sequences A0A1G8PVA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]