SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H2WC39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H2WC39
Domain Number 1 Region: 138-259
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000112
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 277-395
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000379
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H2WC39
Sequence length 398
Comment (tr|A0A1H2WC39|A0A1H2WC39_9BACL) SMI1-KNR4 cell-wall {ECO:0000313|EMBL:SDW78107.1} KW=Complete proteome; Reference proteome OX=1048340 OS=Marininema mesophilum. GN=SAMN05444487_10681 OC=Marininema.
Sequence
MRDEIDFGRGTIIHDTLSFVDRDASLPELFLGEDLLLVMYLQGKFYLDVGWYGSGEGCFI
VRVVSGKREEPFQKNAESWRKLKKVIEEGVAFIHSLMEMPDDVPCYRSQLPPDSISSNNV
DQLLGVVEIEWEDKQSDVALDPLKKLEKVWGVQLPEDLKEIILSCNGGGPLPYQFPLDEE
RWGEFLRLMDFSAKIELDEKLPAGLYPFGNSDRGLLCLDYRVNAGEPAIVIVDLEEEDES
EQVIHLADHFRVFLRSLSNLMGWRRDTTAELRERIAQQLFKLEKEWEITFPTPYKKLVLE
HEGGTPEAPYIYTNRARAEVSHLLQLIDLDAEDSVRRIYQEHFADTKHFPFAMCTNGDIL
CHSYQGEEVTVVLWSQAEDAFHPVNSSFARFLQYLRYQ
Download sequence
Identical sequences A0A1H2WC39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]