SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H6LBX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H6LBX0
Domain Number 1 Region: 228-350
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.71e-31
Family Glutathione peroxidase-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H6LBX0
Sequence length 362
Comment (tr|A0A1H6LBX0|A0A1H6LBX0_PRERU) Thiol-disulfide isomerase or thioredoxin {ECO:0000313|EMBL:SEH83508.1} KW=Complete proteome OX=839 OS=Prevotella ruminicola (Bacteroides ruminicola). GN=SAMN02745192_1689 OC=Prevotella.
Sequence
MKKVFVMMAVLLASVTASANDNFKLTGKIDGASNDTLCIEYTILQPQKQHMVHKVAVKAG
EFLFHANLKEAYSAKMYLKTNPKESLYFYLVPDEEAVFSGSLNSVDEHWSGSTFYQQYER
ITELQRPFNIEFVAARNDPDSIRGEKNRDINRRAHSVYMKYIEEHPDEDATATLIVYVGY
EQVLPAMAKLTPEVRNGRMKSDLDSLERMFKQVLKEAAARKAVKNDTVTIGTQVPELGLK
DLQGNVLELKSLRGKYVVLDFWGSWCTWCIKGFPKLKEYYAKYKDRLEIVGIDCNDTAEK
WAAAVKKHNLPWLQVRSEDGITEDRFRIKGYPYKVLISPEGIVLNAYLGETADFYQYLDT
AL
Download sequence
Identical sequences A0A1H6LBX0 D5EY11
gi|294675355|ref|YP_003575971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]